Wood Stove, Chimney and Fireplace Glass Cleaner

$49.90

- +
Visa, Mastercard, Maestro, American Express, CB, Apple Pay, Google Pay

   Optimal effectiveness : This cleaner for insert, wood stove, and fireplace glass is specially designed to quickly and effectively remove soot, tar, and smoke stains. It works deep down to dissolve even the toughest residues and restores perfect transparency, allowing you to fully enjoy the beauty of the flames without visual obstruction.

   Money-back guarantee : We have total confidence in the effectiveness of our cleaner. If you are not fully satisfied after using it, you are eligible for a full refund. Try it with complete peace of mind and restore your glass surfaces to their original shine without risk.

   Exceptional versatility : This cleaner is not limited to insert glass! It is also effective on pellet stove glass, fireplace doors, barbecue lids, oven windows, and other combustion-stained surfaces, including metal grates, cast iron plates, and some stainless steel parts.

   Cost-effective : Thanks to its 5-liter container and highly concentrated formula, this cleaner offers excellent value. A small amount is enough to clean a large soiled surface. On average, one liter can clean up to 50 m² of glass or metal surfaces, ensuring prolonged and economical use for regular maintenance.

   Safe to use : Unlike aggressive commercial products, this cleaner contains no toxic solvents or harmful substances. It emits no toxic fumes, does not corrode seals, and leaves no chemical residue. It can be safely used indoors while preserving the integrity of treated surfaces.

   Easy to use : This cleaner is ready to use and requires no dilution or preparation. Simply apply it directly to the soiled glass and allow it to act briefly before wiping. Its fast and effective action allows cleaning without effort, avoiding repeated scrubbing.

   Long-lasting durability : By efficiently removing soot and tar, this cleaner prevents premature soiling and extends the lifespan of glass surfaces. Regular maintenance with this product helps keep surfaces clean and functioning longer, without deterioration.

   Fast action : Thanks to its highly reactive formula, this cleaner instantly dissolves carbon deposits and smoke stains. In just a few seconds, it breaks down grime and allows for immediate cleaning. Ideal for quick maintenance, it restores crystal-clear glass in no time.

Usage Instructions

🔹 Preparation : Ensure the glass is cold or slightly warm before applying the product to avoid fast evaporation and maximize effectiveness.

🔹 Application : Apply a small amount of cleaner onto a soft cloth, sponge, or directly onto the glass surface.

🔹 Cleaning : Let the product sit for 2 to 5 minutes to dissolve encrusted residues. Then gently wipe with a clean cloth or non-abrasive sponge. For tougher deposits, use a glass-safe scraper.

🔹 Rinsing : Wipe with a damp cloth to remove any product residue and ensure crystal-clear transparency.

🔹 Drying and finishing : Use a dry, clean cloth to finish and eliminate streaks for a spotless shine.

🔹 Frequency of use : Apply after each use of your stove or fireplace to prevent soot buildup and make regular maintenance easier.

🔹 Storage : Tightly seal the container after each use and store in a cool, dry place, away from light and extreme temperatures, to preserve product effectiveness.

With our insert, wood stove, and fireplace glass cleaner, enjoy spotless glass and a clear view of your fire—without the hassle of cleaning.

Weight N/A
SKU FPWOODSTOVECHIMNEYFIREPLACEGLASSCLEANER5L, FPWOODSTOVECHIMNEYFIREPLACEGLASSCLEANER25L
GTIN 5056773818842, 5056773818859

12 reviews for Wood Stove, Chimney and Fireplace Glass Cleaner

1-12 of 12 reviews
  1. Perfect for regular fireplace glass cleaning.It lifted soot and creosote without needing strong scrubbing.

  2. It helped clear years of buildup from fireplace inserts and made the glass clear again.I appreciated that the cleaner didn’t leave a film and dried fast.The checkout page was simple to use.

  3. Worked well on chimney glass used with pellets and logs.It doesn’t cause streaks and the spray reaches corners easily. The team answered my question about safety with ceramic-coated doors.

  4. I used this to clean a double-sided wood stove and it removed buildup without harming the frame. I asked them one question and they replied within a few minutes to my inquiry.

  5. Great product for seasonal fireplace maintenance.It made my stove door look like new without extra effort.The delivery went smoothly and I received helpful handling advice from customer service.

  6. Cleans soot off fireplace screens effectively and doesn’t leave residue behind.The product has a mild scent and works fast.I placed the order quickly and had updates until arrival.

  7. This cleaner worked better than expected on chimney window panels.It helped restore visibility and left no smears.The product acted quickly and I received delivery confirmation promptly.

  8. I tried this on a small wood stove door and it removed black marks instantly.The liquid applied evenly and didn’t run.The store was easy to use and I liked the courier tracking options.

  9. Helpful for cleaning large fireplace windows after winter use.It tackled stubborn stains and left the glass shining.The site worked well and I got follow-up info about reapplication by email.

  10. Used this on fireplace glass doors and it removed soot easily without scratching.The spray stuck to vertical surfaces and rinsed clean.

  11. I used it during a deep clean before spring and it worked quickly without affecting metal trim.The spray reached high spots and wiped clean.The ordering process was fast and instructions were clear.

  12. Great for cleaning stove glass that builds up with smoke marks.It cleared away residue after one use and left the surface clear.Ordering was fast and I appreciated the clear usage instructions.

Add a review
Currently, we are not accepting new reviews
How do I place an order?

Placing an order on our website is quick and easy. Simply browse our catalog, choose the products you like, and click “Add to cart.” Once you’ve selected all your items, go to your cart and click “Checkout.” Follow the steps on the screen to enter your delivery information, choose your payment method, and confirm your purchase. You will receive an order confirmation by email within a few minutes, along with all the relevant details and a tracking link once your order ships.

Absolutely. We take the security of your personal and financial information very seriously. All payments are processed through a trusted and industry-compliant payment system that adheres to the PCI DSS (Payment Card Industry Data Security Standard). Our website is also protected by a secure SSL certificate, which encrypts all the information you submit, ensuring it cannot be intercepted or misused. You can shop with complete confidence knowing that your transactions are protected at every step.

We accept most major credit and debit cards, and in many countries, we also support local payment methods such as digital wallets or regional options, depending on your location. If you wish to pay via bank transfer, we can accommodate that as well — just contact us beforehand so we can guide you through the process. Please note that bank transfers may take longer to verify and process, which can delay the shipment of your order.

Shipping costs depend on the destination address and the total weight of your order. These costs are calculated automatically at checkout once you’ve entered your delivery address. You will see the final shipping fee before confirming your payment. This ensures that you know exactly what you’re paying, with no surprises. In some cases, free shipping may be offered based on promotions or order value — these offers will be clearly indicated when available.

Yes, we offer international shipping to most countries worldwide, excluding only those under international trade sanctions, such as North Korea, Iran, Syria, Cuba, Russia, Belarus, and the Crimea region.

We currently ship to the following countries:

Africa:
Algeria, Angola, Benin, Botswana, Burkina Faso, Burundi, Cabo Verde, Cameroon, Central African Republic, Chad, Comoros, Republic of the Congo, Democratic Republic of the Congo, Côte d’Ivoire, Djibouti, Egypt, Equatorial Guinea, Eswatini, Ethiopia, Gabon, Gambia, Ghana, Guinea, Guinea-Bissau, Kenya, Lesotho, Liberia, Madagascar, Malawi, Mali, Mauritania, Mauritius, Mayotte, Morocco, Mozambique, Namibia, Niger, Nigeria, Réunion, Rwanda, São Tomé and Príncipe, Saint Helena, Senegal, Seychelles, Sierra Leone, Somalia, South Africa, South Sudan, Sudan, Tanzania, Togo, Tunisia, Uganda, Zambia, Zimbabwe

Asia:
Afghanistan, Armenia, Azerbaijan, Bahrain, Bangladesh, Bhutan, Brunei, Cambodia, China, Georgia, India, Indonesia, Iraq, Israel, Japan, Jordan, Kazakhstan, Kuwait, Kyrgyzstan, Laos, Lebanon, Malaysia, Maldives, Mongolia, Myanmar (Burma), Nepal, Oman, Pakistan, Palestine, Philippines, Qatar, Saudi Arabia, Singapore, South Korea, Sri Lanka, Taiwan, Tajikistan, Thailand, Timor-Leste, Turkey, Turkmenistan, United Arab Emirates, Uzbekistan, Vietnam, Yemen, Christmas Island, Cocos (Keeling) Islands, British Indian Ocean Territory, Macau, Hong Kong

Europe:
Albania, Andorra, Austria, Belgium, Bosnia and Herzegovina, Bulgaria, Croatia, Cyprus, Czech Republic, Denmark, Estonia, Faroe Islands, Finland, France, Germany, Gibraltar, Greece, Guernsey, Hungary, Iceland, Ireland, Isle of Man, Italy, Jersey, Kosovo, Latvia, Liechtenstein, Lithuania, Luxembourg, Malta, Moldova, Monaco, Montenegro, Netherlands, North Macedonia, Norway, Poland, Portugal, Romania, San Marino, Serbia, Slovakia, Slovenia, Spain, Svalbard and Jan Mayen, Sweden, Switzerland, Ukraine, United Kingdom

North America:
Antigua and Barbuda, Bahamas, Barbados, Belize, Bermuda, Canada, Costa Rica, Dominica, Dominican Republic, El Salvador, Greenland, Grenada, Guadeloupe, Guatemala, Haiti, Honduras, Jamaica, Martinique, Mexico, Nicaragua, Panama, Saint Barthélemy, Saint Kitts and Nevis, Saint Lucia, Saint Martin, Saint Pierre and Miquelon, Saint Vincent and the Grenadines, Trinidad and Tobago, United States, Puerto Rico, Guam, U.S. Virgin Islands, American Samoa, Northern Mariana Islands, Montserrat, Anguilla, Turks and Caicos Islands, Cayman Islands, British Virgin Islands, Aruba, Curaçao, Bonaire, Sint Eustatius, Saba, Sint Maarten

South America:
Argentina, Bolivia, Brazil, Chile, Colombia, Ecuador, Falkland Islands, French Guiana, Guyana, Paraguay, Peru, Suriname, Uruguay, Venezuela, South Georgia and the South Sandwich Islands

Oceania:
Australia, Fiji, French Polynesia, Kiribati, Marshall Islands, Micronesia, Nauru, New Caledonia, New Zealand, Niue, Norfolk Island, Palau, Papua New Guinea, Pitcairn Islands, Samoa, Solomon Islands, Tokelau, Tonga, Tuvalu, Vanuatu, Wallis and Futuna

We keep our website up to date in real time. If you see a product available for purchase on the site, it means it is in stock and ready to ship. In the rare event that there is an inventory error or if a product becomes unavailable after you place your order, we will contact you immediately with options, such as a refund or replacement. You can shop with confidence knowing that we only display items that are currently available.

After the shipment of your order, you will receive a shipping confirmation email. In this email, you will find your tracking number to locate your order.

Our customer service is available 24 hours a day, 7 days a week via live chat. Whether you have a question about your order, need help with a product, or run into a technical issue, our team is here to assist you in real time. We aim to respond as quickly as possible and always strive to provide friendly and effective support.

We strive to respond to your questions as quickly as possible. During our business hours, you will receive a response within 30 minutes.

We do our best to ensure that every order is shipped and delivered on time. However, delays may occasionally occur due to external factors like weather, carrier issues, or customs for international shipments. If your package is taking longer than expected, we recommend checking the tracking link you received by email first, as it often provides real-time updates. If the issue persists or there’s no new information, don’t hesitate to contact our support team, and we’ll be happy to assist you in locating your order and resolving any issues.

Yes, we regularly offer special promotions on our products. Make sure to subscribe to our newsletter to receive the latest updates on our exclusive offers.

If you have a promotional code, you can use it during checkout. After entering your shipping details, you’ll see a field labeled “Promo code” or “Discount code.” Simply enter your code there and click “Apply.” If the code is valid, your discount will be reflected immediately in your order total. Please ensure the code is still active and check any terms and conditions related to its use.

To stay updated on news, promotions, and exclusive events, follow us on our social media. You will find all the important information about our online store.

We want you to be fully satisfied with your purchases. If you encounter an issue with a product, please contact our customer service as soon as possible to discuss return or refund options.

Sometimes, your tracking number may take a few days to become active. Please try again later, but if the issue persists, contact us.

The invoice for your order is always sent with your package. If you have lost it, you can also send us an email to receive a copy.

You can create an account either before placing an order or during the checkout process. When you’re about to complete your purchase, simply select the option to “Create an account.” You’ll be asked to provide a few basic details such as your name, email address, and a password. Creating an account allows you to track your orders more easily, save your delivery information for future purchases, and access special offers reserved for our registered customers.

Yes, of course. We understand that not everyone wants to register, so we offer the possibility to checkout as a guest. You’ll still need to enter your shipping and payment details, but you won’t be required to create a password or set up a profile. Please note that if you don’t create an account, you won’t have access to order history or tracking through a personal dashboard — however, you’ll still receive all updates via email.

Send us an email to [email protected], and we will respond as soon as possible.

You may also like

Shopping Cart