Wood Stove, Chimney and Fireplace Glass Cleaner

 
Rated 5.00 out of 5 based on 12 customer ratings
 (12)

$39.90

In Stock

- +

   Money-Back Guarantee

   Express Delivery

   Secure Payment

Visa, Mastercard, Maestro, American Express, CB, Apple Pay, Google Pay

Removes stubborn soot, smoke residue, and burned-on stains with powerful precision. Our wood stove, chimney and fireplace glass cleaner is specially formulated to dissolve and lift heavy carbon deposits, black soot, tar buildup, and smoke film that accumulate on high-temperature glass surfaces. Over time, fireplace and stove glass becomes darkened and cloudy due to combustion residues. This advanced cleaning formula penetrates and breaks down hardened deposits quickly, restoring clarity and allowing you to fully enjoy the warmth and ambiance of your fire again.

We offer a money-back guarantee for complete satisfaction. We are fully confident in the effectiveness of our glass cleaner. If you are not completely satisfied with the results, we will refund your purchase. This money-back guarantee allows you to clean your stove or fireplace glass with total peace of mind, knowing your investment is protected.

The most effective cleaner for fireplace and stove glass on the market. Our high-performance formula is designed specifically for heat-resistant glass surfaces exposed to intense combustion byproducts. Unlike standard household cleaners, it targets the chemical composition of soot and tar, ensuring rapid dissolution and easier removal. It delivers superior cleaning power compared to conventional glass sprays, making it the most effective solution for restoring crystal-clear visibility.

The cheapest professional-grade fireplace glass cleaner available. Premium cleaning performance does not have to be expensive. We offer the most competitive pricing while maintaining high-quality standards. By optimizing production and logistics, we provide a professional-strength cleaner at the lowest price compared to similar products, ensuring excellent value for homeowners and professionals alike.

Guaranteed 24-hour delivery for immediate cleaning needs. When your stove or fireplace glass becomes heavily soiled, quick cleaning restores both appearance and enjoyment. That is why we offer reliable 24-hour delivery, ensuring your cleaner arrives promptly and is ready for use without delay.

Highly concentrated formula for economical use. A small quantity of product effectively treats large glass surfaces. The concentrated formula ensures minimal product usage per cleaning session, delivering excellent cost efficiency while maintaining powerful cleaning performance.

Restores full transparency and improves fire visibility. By eliminating dark stains and smoke haze, the cleaner restores the natural transparency of heat-resistant glass. This enhances the visual appeal of your fireplace or wood stove and improves the overall atmosphere of your living space.

Safe for heat-resistant ceramic and tempered glass. The formula is specifically developed for use on fireplace inserts, wood stove doors, and chimney glass panels. When applied according to instructions, it cleans effectively without scratching or damaging the glass surface.

Reduces future buildup when used regularly. Routine cleaning with our product helps prevent excessive accumulation of soot and tar. Maintaining clean glass improves combustion visibility and simplifies ongoing maintenance.

Easy and fast application for homeowners and professionals. Designed for convenience, the cleaner can be sprayed directly onto the glass and wiped away with a cloth or sponge. Its manageable consistency ensures even coverage and controlled application without complicated procedures.

Instructions

  • Ensure the stove or fireplace glass is completely cool before applying the cleaner.
  • Shake the bottle thoroughly before use.
  • Spray the product evenly onto the soiled glass surface.
  • Allow the cleaner to act for 2 to 5 minutes, depending on the level of soot and residue buildup.
  • Wipe the surface with a damp sponge or cloth to loosen and remove dissolved deposits.
  • For stubborn or thick carbon buildup, gently scrub using a non-abrasive pad or sponge.
  • Remove residue with a clean, damp cloth.
  • Dry the glass with a soft, lint-free cloth to achieve a clear, streak-free finish.
  • Repeat the process if necessary for heavily soiled areas.
  • Avoid contact with painted or delicate surrounding surfaces. Wipe off immediately if accidental contact occurs.
  • Do not use on hot glass or during active combustion.
  • Clean tools and cloths with water after use.
  • Store the product tightly closed in a cool, dry place away from direct sunlight.
  • Keep out of reach of children and follow standard safety precautions during handling and application.
Weight N/A
SKU FPWOODSTOVECHIMNEYFIREPLACEGLASSCLEANER5L, FPWOODSTOVECHIMNEYFIREPLACEGLASSCLEANER25L
GTIN 5056773818842, 5056773818859

12 reviews for Wood Stove, Chimney and Fireplace Glass Cleaner

1-12 of 12 reviews
  1. Wendy O.
    Reviewer

    Perfect for regular fireplace glass cleaning.It lifted soot and creosote without needing strong scrubbing.

  2. Adrian J.
    Reviewer

    It helped clear years of buildup from fireplace inserts and made the glass clear again.I appreciated that the cleaner didn’t leave a film and dried fast.The checkout page was simple to use.

  3. Rosemary H.
    Reviewer

    Worked well on chimney glass used with pellets and logs.It doesn’t cause streaks and the spray reaches corners easily. The team answered my question about safety with ceramic-coated doors.

  4. Lucy L.
    Reviewer

    I used this to clean a double-sided wood stove and it removed buildup without harming the frame. I asked them one question and they replied within a few minutes to my inquiry.

  5. Robert W.
    Reviewer

    Great product for seasonal fireplace maintenance.It made my stove door look like new without extra effort.The delivery went smoothly and I received helpful handling advice from customer service.

  6. Kamila H.
    Reviewer

    Cleans soot off fireplace screens effectively and doesn’t leave residue behind.The product has a mild scent and works fast.I placed the order quickly and had updates until arrival.

  7. Alina X.
    Reviewer

    This cleaner worked better than expected on chimney window panels.It helped restore visibility and left no smears.The product acted quickly and I received delivery confirmation promptly.

  8. Stefanie C.
    Reviewer

    I tried this on a small wood stove door and it removed black marks instantly.The liquid applied evenly and didn’t run.The store was easy to use and I liked the courier tracking options.

  9. Kennedy P.
    Reviewer

    Helpful for cleaning large fireplace windows after winter use.It tackled stubborn stains and left the glass shining.The site worked well and I got follow-up info about reapplication by email.

  10. Hazel M.
    Reviewer

    Used this on fireplace glass doors and it removed soot easily without scratching.The spray stuck to vertical surfaces and rinsed clean.

  11. Theodore M.
    Reviewer

    I used it during a deep clean before spring and it worked quickly without affecting metal trim.The spray reached high spots and wiped clean.The ordering process was fast and instructions were clear.

  12. Gail N.
    Reviewer

    Great for cleaning stove glass that builds up with smoke marks.It cleared away residue after one use and left the surface clear.Ordering was fast and I appreciated the clear usage instructions.

Add a review
Currently, we are not accepting new reviews
How do I place an order?

Placing an order on our website is quick and easy. Simply browse our catalog, choose the products you like, and click “Add to cart.” Once you’ve selected all your items, go to your cart and click “Checkout.” Follow the steps on the screen to enter your delivery information, choose your payment method, and confirm your purchase. You will receive an order confirmation by email within a few minutes, along with all the relevant details and a tracking link once your order ships.

Absolutely. We take the security of your personal and financial information very seriously. All payments are processed through a trusted and industry-compliant payment system that adheres to the PCI DSS (Payment Card Industry Data Security Standard). Our website is also protected by a secure SSL certificate, which encrypts all the information you submit, ensuring it cannot be intercepted or misused. You can shop with complete confidence knowing that your transactions are protected at every step.

We accept most major credit and debit cards, and in many countries, we also support local payment methods such as digital wallets or regional options, depending on your location. If you wish to pay via bank transfer, we can accommodate that as well — just contact us beforehand so we can guide you through the process. Please note that bank transfers may take longer to verify and process, which can delay the shipment of your order.

Shipping costs depend on the destination address and the total weight of your order. These costs are calculated automatically at checkout once you’ve entered your delivery address. You will see the final shipping fee before confirming your payment. This ensures that you know exactly what you’re paying, with no surprises. In some cases, free shipping may be offered based on promotions or order value — these offers will be clearly indicated when available.

Yes, we offer international shipping to most countries worldwide, excluding only those under international trade sanctions, such as North Korea, Iran, Syria, Cuba, Russia, Belarus, and the Crimea region.

We currently ship to the following countries:

Africa:
Algeria, Angola, Benin, Botswana, Burkina Faso, Burundi, Cabo Verde, Cameroon, Central African Republic, Chad, Comoros, Republic of the Congo, Democratic Republic of the Congo, Côte d’Ivoire, Djibouti, Egypt, Equatorial Guinea, Eswatini, Ethiopia, Gabon, Gambia, Ghana, Guinea, Guinea-Bissau, Kenya, Lesotho, Liberia, Madagascar, Malawi, Mali, Mauritania, Mauritius, Mayotte, Morocco, Mozambique, Namibia, Niger, Nigeria, Réunion, Rwanda, São Tomé and Príncipe, Saint Helena, Senegal, Seychelles, Sierra Leone, Somalia, South Africa, South Sudan, Sudan, Tanzania, Togo, Tunisia, Uganda, Zambia, Zimbabwe

Asia:
Afghanistan, Armenia, Azerbaijan, Bahrain, Bangladesh, Bhutan, Brunei, Cambodia, China, Georgia, India, Indonesia, Iraq, Israel, Japan, Jordan, Kazakhstan, Kuwait, Kyrgyzstan, Laos, Lebanon, Malaysia, Maldives, Mongolia, Myanmar (Burma), Nepal, Oman, Pakistan, Palestine, Philippines, Qatar, Saudi Arabia, Singapore, South Korea, Sri Lanka, Taiwan, Tajikistan, Thailand, Timor-Leste, Turkey, Turkmenistan, United Arab Emirates, Uzbekistan, Vietnam, Yemen, Christmas Island, Cocos (Keeling) Islands, British Indian Ocean Territory, Macau, Hong Kong

Europe:
Albania, Andorra, Austria, Belgium, Bosnia and Herzegovina, Bulgaria, Croatia, Cyprus, Czech Republic, Denmark, Estonia, Faroe Islands, Finland, France, Germany, Gibraltar, Greece, Guernsey, Hungary, Iceland, Ireland, Isle of Man, Italy, Jersey, Kosovo, Latvia, Liechtenstein, Lithuania, Luxembourg, Malta, Moldova, Monaco, Montenegro, Netherlands, North Macedonia, Norway, Poland, Portugal, Romania, San Marino, Serbia, Slovakia, Slovenia, Spain, Svalbard and Jan Mayen, Sweden, Switzerland, Ukraine, United Kingdom

North America:
Antigua and Barbuda, Bahamas, Barbados, Belize, Bermuda, Canada, Costa Rica, Dominica, Dominican Republic, El Salvador, Greenland, Grenada, Guadeloupe, Guatemala, Haiti, Honduras, Jamaica, Martinique, Mexico, Nicaragua, Panama, Saint Barthélemy, Saint Kitts and Nevis, Saint Lucia, Saint Martin, Saint Pierre and Miquelon, Saint Vincent and the Grenadines, Trinidad and Tobago, United States, Puerto Rico, Guam, U.S. Virgin Islands, American Samoa, Northern Mariana Islands, Montserrat, Anguilla, Turks and Caicos Islands, Cayman Islands, British Virgin Islands, Aruba, Curaçao, Bonaire, Sint Eustatius, Saba, Sint Maarten

South America:
Argentina, Bolivia, Brazil, Chile, Colombia, Ecuador, Falkland Islands, French Guiana, Guyana, Paraguay, Peru, Suriname, Uruguay, Venezuela, South Georgia and the South Sandwich Islands

Oceania:
Australia, Fiji, French Polynesia, Kiribati, Marshall Islands, Micronesia, Nauru, New Caledonia, New Zealand, Niue, Norfolk Island, Palau, Papua New Guinea, Pitcairn Islands, Samoa, Solomon Islands, Tokelau, Tonga, Tuvalu, Vanuatu, Wallis and Futuna

We keep our website up to date in real time. If you see a product available for purchase on the site, it means it is in stock and ready to ship. In the rare event that there is an inventory error or if a product becomes unavailable after you place your order, we will contact you immediately with options, such as a refund or replacement. You can shop with confidence knowing that we only display items that are currently available.

After the shipment of your order, you will receive a shipping confirmation email. In this email, you will find your tracking number to locate your order.

Our customer service is available 24 hours a day, 7 days a week via live chat. Whether you have a question about your order, need help with a product, or run into a technical issue, our team is here to assist you in real time. We aim to respond as quickly as possible and always strive to provide friendly and effective support.

We strive to respond to your questions as quickly as possible. During our business hours, you will receive a response within 30 minutes.

We do our best to ensure that every order is shipped and delivered on time. However, delays may occasionally occur due to external factors like weather, carrier issues, or customs for international shipments. If your package is taking longer than expected, we recommend checking the tracking link you received by email first, as it often provides real-time updates. If the issue persists or there’s no new information, don’t hesitate to contact our support team, and we’ll be happy to assist you in locating your order and resolving any issues.

Yes, we regularly offer special promotions on our products. Make sure to subscribe to our newsletter to receive the latest updates on our exclusive offers.

If you have a promotional code, you can use it during checkout. After entering your shipping details, you’ll see a field labeled “Promo code” or “Discount code.” Simply enter your code there and click “Apply.” If the code is valid, your discount will be reflected immediately in your order total. Please ensure the code is still active and check any terms and conditions related to its use.

To stay updated on news, promotions, and exclusive events, follow us on our social media. You will find all the important information about our online store.

We want you to be fully satisfied with your purchases. If you encounter an issue with a product, please contact our customer service as soon as possible to discuss return or refund options.

Sometimes, your tracking number may take a few days to become active. Please try again later, but if the issue persists, contact us.

The invoice for your order is always sent with your package. If you have lost it, you can also send us an email to receive a copy.

You can create an account either before placing an order or during the checkout process. When you’re about to complete your purchase, simply select the option to “Create an account.” You’ll be asked to provide a few basic details such as your name, email address, and a password. Creating an account allows you to track your orders more easily, save your delivery information for future purchases, and access special offers reserved for our registered customers.

Yes, of course. We understand that not everyone wants to register, so we offer the possibility to checkout as a guest. You’ll still need to enter your shipping and payment details, but you won’t be required to create a password or set up a profile. Please note that if you don’t create an account, you won’t have access to order history or tracking through a personal dashboard, however, you’ll still receive all updates via email.

Send us an email to [email protected], and we will respond as soon as possible.

You may also like

Shopping Cart