Wood Stove, Chimney and Fireplace Glass Cleaner

£29.90

- +
Visa, Mastercard, Maestro, American Express, CB, Apple Pay, Google Pay

✅   Optimal effectiveness : This cleaner for insert, wood stove, and fireplace glass is specially designed to quickly and effectively remove soot, tar, and smoke stains. It works deep down to dissolve even the toughest residues and restores perfect transparency, allowing you to fully enjoy the beauty of the flames without visual obstruction.

✅  Money-back guarantee : We have total confidence in the effectiveness of our cleaner. If you are not fully satisfied after using it, you are eligible for a full refund. Try it with complete peace of mind and restore your glass surfaces to their original shine without risk.

✅   Exceptional versatility : This cleaner is not limited to insert glass! It is also effective on pellet stove glass, fireplace doors, barbecue lids, oven windows, and other combustion-stained surfaces, including metal grates, cast iron plates, and some stainless steel parts.

✅   Cost-effective : Thanks to its 5-liter container and highly concentrated formula, this cleaner offers excellent value. A small amount is enough to clean a large soiled surface. On average, one liter can clean up to 50 m² of glass or metal surfaces, ensuring prolonged and economical use for regular maintenance.

✅   Safe to use : Unlike aggressive commercial products, this cleaner contains no toxic solvents or harmful substances. It emits no toxic fumes, does not corrode seals, and leaves no chemical residue. It can be safely used indoors while preserving the integrity of treated surfaces.

✅   Easy to use : This cleaner is ready to use and requires no dilution or preparation. Simply apply it directly to the soiled glass and allow it to act briefly before wiping. Its fast and effective action allows cleaning without effort, avoiding repeated scrubbing.

✅   Long-lasting durability : By efficiently removing soot and tar, this cleaner prevents premature soiling and extends the lifespan of glass surfaces. Regular maintenance with this product helps keep surfaces clean and functioning longer, without deterioration.

✅   Fast action : Thanks to its highly reactive formula, this cleaner instantly dissolves carbon deposits and smoke stains. In just a few seconds, it breaks down grime and allows for immediate cleaning. Ideal for quick maintenance, it restores crystal-clear glass in no time.

Usage Instructions

🔹 Preparation : Ensure the glass is cold or slightly warm before applying the product to avoid fast evaporation and maximize effectiveness.

🔹 Application : Apply a small amount of cleaner onto a soft cloth, sponge, or directly onto the glass surface.

🔹 Cleaning : Let the product sit for 2 to 5 minutes to dissolve encrusted residues. Then gently wipe with a clean cloth or non-abrasive sponge. For tougher deposits, use a glass-safe scraper.

🔹 Rinsing : Wipe with a damp cloth to remove any product residue and ensure crystal-clear transparency.

🔹 Drying and finishing : Use a dry, clean cloth to finish and eliminate streaks for a spotless shine.

🔹 Frequency of use : Apply after each use of your stove or fireplace to prevent soot buildup and make regular maintenance easier.

🔹 Storage : Tightly seal the container after each use and store in a cool, dry place, away from light and extreme temperatures, to preserve product effectiveness.

With our insert, wood stove, and fireplace glass cleaner, enjoy spotless glass and a clear view of your fire—without the hassle of cleaning.

Weight N/A
SKU FPWOODSTOVECHIMNEYFIREPLACEGLASSCLEANER5L, FPWOODSTOVECHIMNEYFIREPLACEGLASSCLEANER25L
GTIN 5056773818842, 5056773818859

12 reviews for Wood Stove, Chimney and Fireplace Glass Cleaner

1-12 of 12 reviews
  1. Perfect for regular fireplace glass cleaning.It lifted soot and creosote without needing strong scrubbing.

  2. It helped clear years of buildup from fireplace inserts and made the glass clear again.I appreciated that the cleaner didn’t leave a film and dried fast.The checkout page was simple to use.

  3. Worked well on chimney glass used with pellets and logs.It doesn’t cause streaks and the spray reaches corners easily. The team answered my question about safety with ceramic-coated doors.

  4. I used this to clean a double-sided wood stove and it removed buildup without harming the frame. I asked them one question and they replied within a few minutes to my inquiry.

  5. Great product for seasonal fireplace maintenance.It made my stove door look like new without extra effort.The delivery went smoothly and I received helpful handling advice from customer service.

  6. Cleans soot off fireplace screens effectively and doesn’t leave residue behind.The product has a mild scent and works fast.I placed the order quickly and had updates until arrival.

  7. This cleaner worked better than expected on chimney window panels.It helped restore visibility and left no smears.The product acted quickly and I received delivery confirmation promptly.

  8. I tried this on a small wood stove door and it removed black marks instantly.The liquid applied evenly and didn’t run.The store was easy to use and I liked the courier tracking options.

  9. Helpful for cleaning large fireplace windows after winter use.It tackled stubborn stains and left the glass shining.The site worked well and I got follow-up info about reapplication by email.

  10. Used this on fireplace glass doors and it removed soot easily without scratching.The spray stuck to vertical surfaces and rinsed clean.

  11. I used it during a deep clean before spring and it worked quickly without affecting metal trim.The spray reached high spots and wiped clean.The ordering process was fast and instructions were clear.

  12. Great for cleaning stove glass that builds up with smoke marks.It cleared away residue after one use and left the surface clear.Ordering was fast and I appreciated the clear usage instructions.

Add a review
Currently, we are not accepting new reviews
Shopping Basket