Wood Stove, Chimney and Fireplace Glass Cleaner

£29.90

Visa, Mastercard, Maestro, American Express, CB, Apple Pay, Google Pay

✅   Optimal effectiveness : This cleaner for insert, wood stove, and fireplace glass is specially designed to quickly and effectively remove soot, tar, and smoke stains. It works deep down to dissolve even the toughest residues and restores perfect transparency, allowing you to fully enjoy the beauty of the flames without visual obstruction.

✅  Money-back guarantee : We have total confidence in the effectiveness of our cleaner. If you are not fully satisfied after using it, you are eligible for a full refund. Try it with complete peace of mind and restore your glass surfaces to their original shine without risk.

✅   Exceptional versatility : This cleaner is not limited to insert glass! It is also effective on pellet stove glass, fireplace doors, barbecue lids, oven windows, and other combustion-stained surfaces, including metal grates, cast iron plates, and some stainless steel parts.

✅   Cost-effective : Thanks to its 5-liter container and highly concentrated formula, this cleaner offers excellent value. A small amount is enough to clean a large soiled surface. On average, one liter can clean up to 50 m² of glass or metal surfaces, ensuring prolonged and economical use for regular maintenance.

✅   Safe to use : Unlike aggressive commercial products, this cleaner contains no toxic solvents or harmful substances. It emits no toxic fumes, does not corrode seals, and leaves no chemical residue. It can be safely used indoors while preserving the integrity of treated surfaces.

✅   Easy to use : This cleaner is ready to use and requires no dilution or preparation. Simply apply it directly to the soiled glass and allow it to act briefly before wiping. Its fast and effective action allows cleaning without effort, avoiding repeated scrubbing.

✅   Long-lasting durability : By efficiently removing soot and tar, this cleaner prevents premature soiling and extends the lifespan of glass surfaces. Regular maintenance with this product helps keep surfaces clean and functioning longer, without deterioration.

✅   Fast action : Thanks to its highly reactive formula, this cleaner instantly dissolves carbon deposits and smoke stains. In just a few seconds, it breaks down grime and allows for immediate cleaning. Ideal for quick maintenance, it restores crystal-clear glass in no time.

Usage Instructions

🔹 Preparation : Ensure the glass is cold or slightly warm before applying the product to avoid fast evaporation and maximize effectiveness.

🔹 Application : Apply a small amount of cleaner onto a soft cloth, sponge, or directly onto the glass surface.

🔹 Cleaning : Let the product sit for 2 to 5 minutes to dissolve encrusted residues. Then gently wipe with a clean cloth or non-abrasive sponge. For tougher deposits, use a glass-safe scraper.

🔹 Rinsing : Wipe with a damp cloth to remove any product residue and ensure crystal-clear transparency.

🔹 Drying and finishing : Use a dry, clean cloth to finish and eliminate streaks for a spotless shine.

🔹 Frequency of use : Apply after each use of your stove or fireplace to prevent soot buildup and make regular maintenance easier.

🔹 Storage : Tightly seal the container after each use and store in a cool, dry place, away from light and extreme temperatures, to preserve product effectiveness.

With our insert, wood stove, and fireplace glass cleaner, enjoy spotless glass and a clear view of your fire—without the hassle of cleaning.

Weight N/A
SKU FPWOODSTOVECHIMNEYFIREPLACEGLASSCLEANER5L, FPWOODSTOVECHIMNEYFIREPLACEGLASSCLEANER25L
GTIN 5056773818842, 5056773818859

Reviews

There are no reviews yet

Add a review
Currently, we are not accepting new reviews
Shopping Basket